Class b: All beta proteins [48724] (174 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (13 families) |
Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain |
Protein ATP sulfurylase N-terminal domain [63802] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries) |
Domain d1g8hb1: 1g8h B:2-168 [60360] Other proteins in same PDB: d1g8ha2, d1g8ha3, d1g8hb2, d1g8hb3 complexed with acy, adx, ca, cd, mg, na, pop |
PDB Entry: 1g8h (more details), 2.8 Å
SCOP Domain Sequences for d1g8hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8hb1 b.122.1.3 (B:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd
Timeline for d1g8hb1: