Lineage for d1g8hb1 (1g8h B:2-168)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569757Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 569758Superfamily b.122.1: PUA domain-like [88697] (7 families) (S)
  5. 569802Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 569803Protein ATP sulfurylase N-terminal domain [63802] (4 species)
  7. 569804Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)
  8. 569815Domain d1g8hb1: 1g8h B:2-168 [60360]
    Other proteins in same PDB: d1g8ha2, d1g8ha3, d1g8hb2, d1g8hb3
    complexed with acy, adx, ca, cd, mg, na, pop

Details for d1g8hb1

PDB Entry: 1g8h (more details), 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8hb1 b.122.1.3 (B:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1g8hb1:

Click to download the PDB-style file with coordinates for d1g8hb1.
(The format of our PDB-style files is described here.)

Timeline for d1g8hb1: