Lineage for d1g8hb1 (1g8h B:2-168)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232326Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 232327Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 232418Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
    incomplete barrel of 6 strands, the last PK strand is missing
  6. 232419Protein ATP sulfurylase N-terminal domain [63802] (3 species)
  7. 232420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (6 PDB entries)
  8. 232428Domain d1g8hb1: 1g8h B:2-168 [60360]
    Other proteins in same PDB: d1g8ha2, d1g8ha3, d1g8hb2, d1g8hb3
    complexed with acy, adx, ca, cd, mg, na, pop

Details for d1g8hb1

PDB Entry: 1g8h (more details), 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8hb1 b.58.1.2 (B:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1g8hb1:

Click to download the PDB-style file with coordinates for d1g8hb1.
(The format of our PDB-style files is described here.)

Timeline for d1g8hb1: