Lineage for d1g8ha3 (1g8h A:390-511)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70404Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)
  6. 70405Protein ATP sulfurylase C-terminal domain [64012] (2 species)
  7. 70406Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (3 PDB entries)
  8. 70410Domain d1g8ha3: 1g8h A:390-511 [60359]
    Other proteins in same PDB: d1g8ha1, d1g8ha2, d1g8hb1, d1g8hb2

Details for d1g8ha3

PDB Entry: 1g8h (more details), 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ha3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipdqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf

SCOP Domain Coordinates for d1g8ha3:

Click to download the PDB-style file with coordinates for d1g8ha3.
(The format of our PDB-style files is described here.)

Timeline for d1g8ha3: