![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein) |
![]() | Protein ATP sulfurylase central domain [63980] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (7 PDB entries) |
![]() | Domain d1g8ha2: 1g8h A:169-389 [60358] Other proteins in same PDB: d1g8ha1, d1g8ha3, d1g8hb1, d1g8hb3 |
PDB Entry: 1g8h (more details), 2.8 Å
SCOP Domain Sequences for d1g8ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8ha2 c.26.1.5 (A:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)} ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp
Timeline for d1g8ha2: