Lineage for d1g8ha2 (1g8h A:169-389)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121076Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 121077Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 121178Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 121179Protein ATP sulfurylase central domain [63980] (3 species)
  7. 121180Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (6 PDB entries)
  8. 121187Domain d1g8ha2: 1g8h A:169-389 [60358]
    Other proteins in same PDB: d1g8ha1, d1g8ha3, d1g8hb1, d1g8hb3

Details for d1g8ha2

PDB Entry: 1g8h (more details), 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ha2 c.26.1.5 (A:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOP Domain Coordinates for d1g8ha2:

Click to download the PDB-style file with coordinates for d1g8ha2.
(The format of our PDB-style files is described here.)

Timeline for d1g8ha2: