Lineage for d1g8ha2 (1g8h A:169-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860766Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins)
    automatically mapped to Pfam PF01747
  6. 2860767Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2860768Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (8 PDB entries)
  8. 2860778Domain d1g8ha2: 1g8h A:169-389 [60358]
    Other proteins in same PDB: d1g8ha1, d1g8ha3, d1g8hb1, d1g8hb3
    complexed with acy, adx, ca, cd, mg, na, pop

Details for d1g8ha2

PDB Entry: 1g8h (more details), 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi
PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1g8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ha2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOPe Domain Coordinates for d1g8ha2:

Click to download the PDB-style file with coordinates for d1g8ha2.
(The format of our PDB-style files is described here.)

Timeline for d1g8ha2: