Lineage for d1g8ha1 (1g8h A:2-168)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472865Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 472866Superfamily b.122.1: PUA domain-like [88697] (4 families) (S)
  5. 472906Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 472907Protein ATP sulfurylase N-terminal domain [63802] (4 species)
  7. 472908Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)
  8. 472918Domain d1g8ha1: 1g8h A:2-168 [60357]
    Other proteins in same PDB: d1g8ha2, d1g8ha3, d1g8hb2, d1g8hb3

Details for d1g8ha1

PDB Entry: 1g8h (more details), 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ha1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1g8ha1:

Click to download the PDB-style file with coordinates for d1g8ha1.
(The format of our PDB-style files is described here.)

Timeline for d1g8ha1: