![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (3 families) ![]() |
![]() | Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain |
![]() | Protein ATP sulfurylase N-terminal domain [63802] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (7 PDB entries) |
![]() | Domain d1g8ha1: 1g8h A:2-168 [60357] Other proteins in same PDB: d1g8ha2, d1g8ha3, d1g8hb2, d1g8hb3 |
PDB Entry: 1g8h (more details), 2.8 Å
SCOP Domain Sequences for d1g8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8ha1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd
Timeline for d1g8ha1: