SCOP 1.57: Domain d1g8ha1: 1g8h A:2-168

Lineage for d1g8ha1 (1g8h A:2-168)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)

6. Protein ATP sulfurylase N-terminal domain [63802] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (3 PDB entries)

8. Domain d1g8ha1: 1g8h A:2-168 [60357]
   Other proteins in same PDB: d1g8ha2, d1g8ha3, d1g8hb2, d1g8hb3

Details for d1g8ha1

PDB Entry: 1g8h, 2.8 Å

PDB Description: atp sulfurylase from s. cerevisiae: the ternary product complex with aps and ppi

SCOP Domain Sequences for d1g8ha1:

Sequence; same for both SEQRES and ATOM records:

>d1g8ha1 b.58.1.2 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1g8ha1:

• d1g8ha1 is new in SCOP 1.57
  
• d1g8ha1 appears in SCOP 1.59
  
• d1g8ha1 appears in the current release, SCOPe 2.08