Lineage for d1g8gb3 (1g8g B:390-511)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697421Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)
  6. 697422Protein ATP sulfurylase C-terminal domain [64012] (2 species)
  7. 697423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (7 PDB entries)
  8. 697430Domain d1g8gb3: 1g8g B:390-511 [60356]
    Other proteins in same PDB: d1g8ga1, d1g8ga2, d1g8gb1, d1g8gb2
    complexed with acy, adx, ca, cd, mg, na, trs

Details for d1g8gb3

PDB Entry: 1g8g (more details), 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps
PDB Compounds: (B:) sulfate adenylyltransferase

SCOP Domain Sequences for d1g8gb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8gb3 c.37.1.15 (B:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipdqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf

SCOP Domain Coordinates for d1g8gb3:

Click to download the PDB-style file with coordinates for d1g8gb3.
(The format of our PDB-style files is described here.)

Timeline for d1g8gb3: