SCOP 1.57: Domain d1g8gb2: 1g8g B:169-389

Lineage for d1g8gb2 (1g8g B:169-389)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)

6. Protein ATP sulfurylase central domain [63980] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (3 PDB entries)

8. Domain d1g8gb2: 1g8g B:169-389 [60355]
   Other proteins in same PDB: d1g8ga1, d1g8ga3, d1g8gb1, d1g8gb3

Details for d1g8gb2

PDB Entry: 1g8g, 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps

SCOP Domain Sequences for d1g8gb2:

Sequence; same for both SEQRES and ATOM records:

>d1g8gb2 c.26.1.5 (B:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

Timeline for d1g8gb2:

• d1g8gb2 is new in SCOP 1.57
  
• d1g8gb2 appears in SCOP 1.59
  
• d1g8gb2 appears in the current release, SCOPe 2.08