![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily) multihelical; forms intertwined dimer of identical 5-helical subunits |
![]() | Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) ![]() |
![]() | Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein) contains an HTH motif |
![]() | Protein Flagellar transcriptional activator FlhD [63594] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63595] (3 PDB entries) |
![]() | Domain d1g8eb_: 1g8e B: [60347] |
PDB Entry: 1g8e (more details), 1.8 Å
SCOPe Domain Sequences for d1g8eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8eb_ a.145.1.1 (B:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]} tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq lvchfrfdshqtitqltqds
Timeline for d1g8eb_: