SCOP 1.71: Domain d1g8eb_: 1g8e B:

Lineage for d1g8eb_ (1g8e B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
   multihelical; forms intertwined dimer of identical 5-helical subunits

4. Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family)

5. Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
   contains an HTH motif

6. Protein Flagellar transcriptional activator FlhD [63594] (1 species)

7. Species Escherichia coli [TaxId:562] [63595] (1 PDB entry)

8. Domain d1g8eb_: 1g8e B: [60347]

Details for d1g8eb_

PDB Entry: 1g8e, 1.8 Å

PDB Description: crystal structure of flhd from escherichia coli

SCOP Domain Sequences for d1g8eb_:

Sequence; same for both SEQRES and ATOM records:

>d1g8eb_ a.145.1.1 (B:) Flagellar transcriptional activator FlhD {Escherichia coli}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitqltqds

Timeline for d1g8eb_:

• d1g8eb_ first appeared in SCOP 1.57
  
• d1g8eb_ appears in SCOP 1.69
  
• d1g8eb_ appears in SCOP 1.73
  
• d1g8eb_ appears in the current release, SCOPe 2.08