SCOPe 2.07: Domain d1g8ea_: 1g8e A:

Lineage for d1g8ea_ (1g8e A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
   multihelical; forms intertwined dimer of identical 5-helical subunits

4. Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family)

5. Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
   contains an HTH motif

6. Protein Flagellar transcriptional activator FlhD [63594] (1 species)

7. Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)

8. Domain d1g8ea_: 1g8e A: [60346]

Details for d1g8ea_

PDB Entry: 1g8e, 1.8 Å

PDB Description: crystal structure of flhd from escherichia coli

PDB Compounds: (A:) flagellar transcriptional activator flhd

SCOPe Domain Sequences for d1g8ea_:

Sequence; same for both SEQRES and ATOM records:

>d1g8ea_ a.145.1.1 (A:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
nqlvchfrfdshqtitqltqdsrvddlqqihtgimlst

Timeline for d1g8ea_:

• d1g8ea_ first appeared in SCOP 1.57
  
• d1g8ea_ appears in SCOPe 2.06
  
• d1g8ea_ appears in the current release, SCOPe 2.08