Lineage for d1g8ea_ (1g8e A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013305Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
    multihelical; forms intertwined dimer of identical 5-helical subunits
  4. 2013306Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) (S)
  5. 2013307Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
    contains an HTH motif
  6. 2013308Protein Flagellar transcriptional activator FlhD [63594] (1 species)
  7. 2013309Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)
  8. 2013310Domain d1g8ea_: 1g8e A: [60346]

Details for d1g8ea_

PDB Entry: 1g8e (more details), 1.8 Å

PDB Description: crystal structure of flhd from escherichia coli
PDB Compounds: (A:) flagellar transcriptional activator flhd

SCOPe Domain Sequences for d1g8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ea_ a.145.1.1 (A:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
nqlvchfrfdshqtitqltqdsrvddlqqihtgimlst

SCOPe Domain Coordinates for d1g8ea_:

Click to download the PDB-style file with coordinates for d1g8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1g8ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g8eb_