Lineage for d1g84a_ (1g84 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159441Species C epsilon2 domain from IgE (human) [63660] (1 PDB entry)
  8. 159442Domain d1g84a_: 1g84 A: [60345]

Details for d1g84a_

PDB Entry: 1g84 (more details)

PDB Description: the solution structure of the c epsilon2 domain from ige

SCOP Domain Sequences for d1g84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g84a_ b.1.1.2 (A:) Immunoglobulin (constant domains of L and H chains) {C epsilon2 domain from IgE (human)}
srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast
tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa

SCOP Domain Coordinates for d1g84a_:

Click to download the PDB-style file with coordinates for d1g84a_.
(The format of our PDB-style files is described here.)

Timeline for d1g84a_: