Lineage for d1g83a2 (1g83 A:142-245)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136128Protein Tyrosine kinase Fyn [55559] (1 species)
  7. 136129Species Human (Homo sapiens) [TaxId:9606] [55560] (3 PDB entries)
  8. 136130Domain d1g83a2: 1g83 A:142-245 [60342]
    Other proteins in same PDB: d1g83a1, d1g83b1

Details for d1g83a2

PDB Entry: 1g83 (more details), 2.6 Å

PDB Description: crystal structure of fyn sh3-sh2

SCOP Domain Sequences for d1g83a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens)}
dsiqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvk
hykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvp

SCOP Domain Coordinates for d1g83a2:

Click to download the PDB-style file with coordinates for d1g83a2.
(The format of our PDB-style files is described here.)

Timeline for d1g83a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g83a1