SCOP 1.63: Domain d1g82d_: 1g82 D:

Lineage for d1g82d_ (1g82 D:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins)

6. Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries)

8. Domain d1g82d_: 1g82 D: [60340]
   complexed with fuc, nag, so4

Details for d1g82d_

PDB Entry: 1g82, 2.6 Å

PDB Description: structure of fibroblast growth factor 9

SCOP Domain Sequences for d1g82d_:

Sequence; same for both SEQRES and ATOM records:

>d1g82d_ b.42.1.1 (D:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens)}
pavtdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsir
gvdsglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnk
dgtpregtrtkrhqkfthflprpvdpdkvpelykd

Timeline for d1g82d_:

• d1g82d_ first appeared in SCOP 1.57
  
• d1g82d_ appears in SCOP 1.61
  
• d1g82d_ appears in SCOP 1.65
  
• d1g82d_ appears in the current release, SCOPe 2.08