Lineage for d1g82d_ (1g82 D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59922Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)
  7. 59923Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries)
  8. 59928Domain d1g82d_: 1g82 D: [60340]

Details for d1g82d_

PDB Entry: 1g82 (more details), 2.6 Å

PDB Description: structure of fibroblast growth factor 9

SCOP Domain Sequences for d1g82d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g82d_ b.42.1.1 (D:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens)}
pavtdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsir
gvdsglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnk
dgtpregtrtkrhqkfthflprpvdpdkvpelykd

SCOP Domain Coordinates for d1g82d_:

Click to download the PDB-style file with coordinates for d1g82d_.
(The format of our PDB-style files is described here.)

Timeline for d1g82d_: