SCOPe 2.03: Domain d1g82c_: 1g82 C:

Lineage for d1g82c_ (1g82 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries)

8. Domain d1g82c_: 1g82 C: [60339]
   complexed with nag, so4

Details for d1g82c_

PDB Entry: 1g82, 2.6 Å

PDB Description: structure of fibroblast growth factor 9

PDB Compounds: (C:) fibroblast growth factor 9

SCOPe Domain Sequences for d1g82c_:

Sequence; same for both SEQRES and ATOM records:

>d1g82c_ b.42.1.1 (C:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]}
tdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvd
sglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgt
pregtrtkrhqkfthflprpvdpdkvpelykdils

Timeline for d1g82c_:

• d1g82c_ first appeared in SCOP 1.57
  
• d1g82c_ appears in SCOPe 2.02
  
• d1g82c_ appears in SCOPe 2.04
  
• d1g82c_ appears in the current release, SCOPe 2.08