Lineage for d1g82b_ (1g82 B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167295Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 167296Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 167297Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 167386Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)
  7. 167387Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries)
  8. 167390Domain d1g82b_: 1g82 B: [60338]

Details for d1g82b_

PDB Entry: 1g82 (more details), 2.6 Å

PDB Description: structure of fibroblast growth factor 9

SCOP Domain Sequences for d1g82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g82b_ b.42.1.1 (B:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens)}
vtdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgv
dsglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdg
tpregtrtkrhqkfthflprpvdpdkvpelykdilsq

SCOP Domain Coordinates for d1g82b_:

Click to download the PDB-style file with coordinates for d1g82b_.
(The format of our PDB-style files is described here.)

Timeline for d1g82b_: