Lineage for d1g82b_ (1g82 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791887Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)
  7. 2791888Species Human (Homo sapiens) [TaxId:9606] [63782] (3 PDB entries)
  8. 2791891Domain d1g82b_: 1g82 B: [60338]
    complexed with nag, so4

Details for d1g82b_

PDB Entry: 1g82 (more details), 2.6 Å

PDB Description: structure of fibroblast growth factor 9
PDB Compounds: (B:) fibroblast growth factor 9

SCOPe Domain Sequences for d1g82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g82b_ b.42.1.1 (B:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]}
vtdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgv
dsglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdg
tpregtrtkrhqkfthflprpvdpdkvpelykdilsq

SCOPe Domain Coordinates for d1g82b_:

Click to download the PDB-style file with coordinates for d1g82b_.
(The format of our PDB-style files is described here.)

Timeline for d1g82b_: