![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (2 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins) |
![]() | Protein Fibroblast growth factor 9, FGF9 [63781] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries) |
![]() | Domain d1g82a_: 1g82 A: [60337] |
PDB Entry: 1g82 (more details), 2.6 Å
SCOP Domain Sequences for d1g82a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g82a_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens)} tdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvd sglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgt pregtrtkrhqkfthflprpvdpdkvpelykdilsqs
Timeline for d1g82a_: