Lineage for d1g82a_ (1g82 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229692Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 229693Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 229694Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins)
  6. 229783Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)
  7. 229784Species Human (Homo sapiens) [TaxId:9606] [63782] (2 PDB entries)
  8. 229786Domain d1g82a_: 1g82 A: [60337]

Details for d1g82a_

PDB Entry: 1g82 (more details), 2.6 Å

PDB Description: structure of fibroblast growth factor 9

SCOP Domain Sequences for d1g82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g82a_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens)}
tdldhlkgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvd
sglylgmnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgt
pregtrtkrhqkfthflprpvdpdkvpelykdilsqs

SCOP Domain Coordinates for d1g82a_:

Click to download the PDB-style file with coordinates for d1g82a_.
(The format of our PDB-style files is described here.)

Timeline for d1g82a_: