Lineage for d1g7va_ (1g7v A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174007Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 174217Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 174236Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (2 species)
  7. 174258Species Escherichia coli [TaxId:562] [51603] (4 PDB entries)
  8. 174263Domain d1g7va_: 1g7v A: [60335]

Details for d1g7va_

PDB Entry: 1g7v (more details), 2.4 Å

PDB Description: crystal structures of kdo8p synthase in its binary complexes with the mechanism-based inhibitor

SCOP Domain Sequences for d1g7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7va_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

SCOP Domain Coordinates for d1g7va_:

Click to download the PDB-style file with coordinates for d1g7va_.
(The format of our PDB-style files is described here.)

Timeline for d1g7va_: