Lineage for d1g7ua_ (1g7u A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117047Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 117233Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 117244Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (2 species)
  7. 117266Species Escherichia coli [TaxId:562] [51603] (4 PDB entries)
  8. 117273Domain d1g7ua_: 1g7u A: [60334]

Details for d1g7ua_

PDB Entry: 1g7u (more details), 2.8 Å

PDB Description: crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate

SCOP Domain Sequences for d1g7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ua_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfvaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

SCOP Domain Coordinates for d1g7ua_:

Click to download the PDB-style file with coordinates for d1g7ua_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ua_: