Lineage for d1g7ua_ (1g7u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835611Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (5 species)
  7. 2835709Species Escherichia coli [TaxId:562] [51603] (10 PDB entries)
    Uniprot P17579
  8. 2835722Domain d1g7ua_: 1g7u A: [60334]
    complexed with pep

Details for d1g7ua_

PDB Entry: 1g7u (more details), 2.8 Å

PDB Description: crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d1g7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ua_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli [TaxId: 562]}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfvaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

SCOPe Domain Coordinates for d1g7ua_:

Click to download the PDB-style file with coordinates for d1g7ua_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ua_: