Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (7 species) |
Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (263 PDB entries) Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299 |
Domain d1g7ga_: 1g7g A: [60331] complexed with inx |
PDB Entry: 1g7g (more details), 2.2 Å
SCOPe Domain Sequences for d1g7ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7ga_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
Timeline for d1g7ga_: