Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein Histone methyltransferase clr4, chromo domain [64217] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [64218] (1 PDB entry) |
Domain d1g6za1: 1g6z A:2-69 [60321] Other proteins in same PDB: d1g6za2 |
PDB Entry: 1g6z (more details)
SCOPe Domain Sequences for d1g6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6za1 b.34.13.2 (A:2-69) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} spkqeeyeverivdekldrngavklyrirwlnyssrsdtweppenlsgcsavlaewkrrk rrlkgsns
Timeline for d1g6za1: