Lineage for d1g6za1 (1g6z A:2-69)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394676Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2394746Protein Histone methyltransferase clr4, chromo domain [64217] (1 species)
  7. 2394747Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [64218] (1 PDB entry)
  8. 2394748Domain d1g6za1: 1g6z A:2-69 [60321]
    Other proteins in same PDB: d1g6za2

Details for d1g6za1

PDB Entry: 1g6z (more details)

PDB Description: solution structure of the clr4 chromo domain
PDB Compounds: (A:) clr4 protein

SCOPe Domain Sequences for d1g6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6za1 b.34.13.2 (A:2-69) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
spkqeeyeverivdekldrngavklyrirwlnyssrsdtweppenlsgcsavlaewkrrk
rrlkgsns

SCOPe Domain Coordinates for d1g6za1:

Click to download the PDB-style file with coordinates for d1g6za1.
(The format of our PDB-style files is described here.)

Timeline for d1g6za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g6za2