![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.6: Antifungal protein AFP1 [63693] (1 protein) shares putative chitin-binding site with SKLP |
![]() | Protein Antifungal protein AFP1 [63694] (1 species) |
![]() | Species Streptomyces tendae, tu901 [TaxId:1932] [63695] (2 PDB entries) |
![]() | Domain d1g6ea_: 1g6e A: [60317] |
PDB Entry: 1g6e (more details)
SCOPe Domain Sequences for d1g6ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6ea_ b.11.1.6 (A:) Antifungal protein AFP1 {Streptomyces tendae, tu901 [TaxId: 1932]} minrtdcnensyleihnnegrdtlcfanagtmpvaiygvnwvesgnnvvtlqfqrnlsdp rletitlqkwgswnpghiheilsiriy
Timeline for d1g6ea_: