SCOPe 2.06: Domain d1g6ea_: 1g6e A:

Lineage for d1g6ea_ (1g6e A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.6: Antifungal protein AFP1 [63693] (1 protein)
   shares putative chitin-binding site with SKLP

6. Protein Antifungal protein AFP1 [63694] (1 species)

7. Species Streptomyces tendae, tu901 [TaxId:1932] [63695] (2 PDB entries)

8. Domain d1g6ea_: 1g6e A: [60317]

Details for d1g6ea_

PDB Entry: 1g6e

PDB Description: antifungal protein from streptomyces tendae tu901, 30-conformers ensemble

PDB Compounds: (A:) antifungal protein

SCOPe Domain Sequences for d1g6ea_:

Sequence; same for both SEQRES and ATOM records:

>d1g6ea_ b.11.1.6 (A:) Antifungal protein AFP1 {Streptomyces tendae, tu901 [TaxId: 1932]}
minrtdcnensyleihnnegrdtlcfanagtmpvaiygvnwvesgnnvvtlqfqrnlsdp
rletitlqkwgswnpghiheilsiriy

Timeline for d1g6ea_:

• d1g6ea_ first appeared in SCOP 1.57
  
• d1g6ea_ appears in SCOPe 2.05
  
• d1g6ea_ appears in SCOPe 2.07
  
• d1g6ea_ appears in the current release, SCOPe 2.08