| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) ![]() automatically mapped to Pfam PF02581 |
| Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins) |
| Protein Thiamin phosphate synthase [51393] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries) |
| Domain d1g69b1: 1g69 B:1014-1235 [60314] Other proteins in same PDB: d1g69a2, d1g69b2 complexed with icp, mg, pop, tzp |
PDB Entry: 1g69 (more details), 1.5 Å
SCOPe Domain Sequences for d1g69b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g69b1 c.1.3.1 (B:1014-1235) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidn
aapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
Timeline for d1g69b1: