SCOPe 2.05: Domain d1g69a_: 1g69 A:

Lineage for d1g69a_ (1g69 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families)
   automatically mapped to Pfam PF02581

5. Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)

6. Protein Thiamin phosphate synthase [51393] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)

8. Domain d1g69a_: 1g69 A: [60313]
   complexed with icp, mg, pop, tzp

Details for d1g69a_

PDB Entry: 1g69, 1.5 Å

PDB Description: thiamin phosphate synthase

PDB Compounds: (A:) thiamin phosphate synthase

SCOPe Domain Sequences for d1g69a_:

Sequence; same for both SEQRES and ATOM records:

>d1g69a_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
aahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

Timeline for d1g69a_:

• d1g69a_ first appeared in SCOP 1.57
  
• d1g69a_ appears in SCOPe 2.04
  
• d1g69a_ is called d1g69a1 in SCOPe 2.06
  
• d1g69a_ appears in the current release, SCOPe 2.08, called d1g69a1