Lineage for d1g67b1 (1g67 B:1014-1235)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436480Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2436481Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)
  6. 2436482Protein Thiamin phosphate synthase [51393] (2 species)
  7. 2436483Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)
  8. 2436487Domain d1g67b1: 1g67 B:1014-1235 [60312]
    Other proteins in same PDB: d1g67a2, d1g67b2
    complexed with icp, mg, pop, tzp

Details for d1g67b1

PDB Entry: 1g67 (more details), 1.4 Å

PDB Description: thiamin phosphate synthase
PDB Compounds: (B:) thiamin phosphate synthase

SCOPe Domain Sequences for d1g67b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g67b1 c.1.3.1 (B:1014-1235) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidn
aapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

SCOPe Domain Coordinates for d1g67b1:

Click to download the PDB-style file with coordinates for d1g67b1.
(The format of our PDB-style files is described here.)

Timeline for d1g67b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g67b2