SCOPe 2.01: Domain d1g5za_: 1g5z A:

Lineage for d1g5za_ (1g5z A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families)

5. Family a.24.12.1: Outer surface protein C (OspC) [63516] (1 protein)

6. Protein Outer surface protein C (OspC) [63517] (1 species)

7. Species Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId:139] [63518] (3 PDB entries)

8. Domain d1g5za_: 1g5z A: [60298]

Details for d1g5za_

PDB Entry: 1g5z, 2.51 Å

PDB Description: crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40

PDB Compounds: (A:) outer surface protein c

SCOPe Domain Sequences for d1g5za_:

Sequence; same for both SEQRES and ATOM records:

>d1g5za_ a.24.12.1 (A:) Outer surface protein C (OspC) {Lyme disease spirochete (Borrelia burgdorferi), different strains [TaxId: 139]}
pnlteiskkitesnavvlavkevetllasidelatkaigkkignngleanqskntsllsg
ayaisdliaeklnvlkneelkekidtakqcsteftnklksehavlgldnltddnaqrail
kkhankdkgaaeleklfkavenlskaaqdtlknavkeltspiva

Timeline for d1g5za_:

• d1g5za_ first appeared in SCOP 1.57
  
• d1g5za_ appears in SCOP 1.75
  
• d1g5za_ appears in SCOPe 2.02
  
• d1g5za_ appears in the current release, SCOPe 2.08