Lineage for d1g5yc_ (1g5y C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729469Domain d1g5yc_: 1g5y C: [60296]
    complexed with rea

Details for d1g5yc_

PDB Entry: 1g5y (more details), 2 Å

PDB Description: the 2.0 angstrom resolution crystal structure of the rxralpha ligand binding domain tetramer in the presence of a non-activating retinoic acid isomer.
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1g5yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5yc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemle

SCOPe Domain Coordinates for d1g5yc_:

Click to download the PDB-style file with coordinates for d1g5yc_.
(The format of our PDB-style files is described here.)

Timeline for d1g5yc_: