Lineage for d1g5yb_ (1g5y B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923849Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 923850Species Human (Homo sapiens) [TaxId:9606] [48511] (32 PDB entries)
    Uniprot P19793 227-458
  8. 923868Domain d1g5yb_: 1g5y B: [60295]
    complexed with rea

Details for d1g5yb_

PDB Entry: 1g5y (more details), 2 Å

PDB Description: the 2.0 angstrom resolution crystal structure of the rxralpha ligand binding domain tetramer in the presence of a non-activating retinoic acid isomer.
PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1g5yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5yb_ a.123.1.1 (B:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph

SCOPe Domain Coordinates for d1g5yb_:

Click to download the PDB-style file with coordinates for d1g5yb_.
(The format of our PDB-style files is described here.)

Timeline for d1g5yb_: