Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein Survival motor neuron protein 1, smn [63750] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63751] (2 PDB entries) |
Domain d1g5va_: 1g5v A: [60292] |
PDB Entry: 1g5v (more details)
SCOPe Domain Sequences for d1g5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5va_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspi
Timeline for d1g5va_: