Lineage for d1g5va_ (1g5v A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784737Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1784738Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 1784806Protein Survival motor neuron protein 1, smn [63750] (1 species)
  7. 1784807Species Human (Homo sapiens) [TaxId:9606] [63751] (2 PDB entries)
  8. 1784809Domain d1g5va_: 1g5v A: [60292]

Details for d1g5va_

PDB Entry: 1g5v (more details)

PDB Description: solution structure of the tudor domain of the human smn protein
PDB Compounds: (A:) survival motor neuron protein 1

SCOPe Domain Sequences for d1g5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5va_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]}
qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspi

SCOPe Domain Coordinates for d1g5va_:

Click to download the PDB-style file with coordinates for d1g5va_.
(The format of our PDB-style files is described here.)

Timeline for d1g5va_: