Lineage for d1g5qa_ (1g5q A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.34: DFP DNA/pantothenate metabolism flavoprotein [52506] (1 superfamily) Superfamily c.34.1: DFP DNA/pantothenate metabolism flavoprotein [52507] (1 family) 
Family c.34.1.1: DFP DNA/pantothenate metabolism flavoprotein [52508] (2 proteins) 
Protein Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD [63996] (1 species) Species Staphylococcus epidermidis [TaxId:1282] [63997] (2 PDB entries) 
Domain d1g5qa_: 1g5q A: [60288]
Details for d1g5qa_
PDB Entry: 1g5q (more details), 2.57 Å
PDB Description: epid h67n complexed with substrate peptide dsytc
SCOP Domain Sequences for d1g5qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis}
mygkllicatasinvininhyivelkqhfdevnilfspssknfintdvlklfcdnlydei
kdpllnninivenheyilvlpasantinkiangicdnllttvcltgyqklfifpnmnirm
wgnpflqknidllknndvkvyspdmnksfeissgryknnitmpnienvlnfvln
SCOP Domain Coordinates for d1g5qa_:
Click to download the PDB-style file with coordinates for d1g5qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g5qa_:
- d1g5qa_ is new in SCOP 1.57
- d1g5qa_ appears in SCOP 1.59
- d1g5qa_ appears in the current release, SCOPe 2.08
View in 3D
