Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [64350] (2 PDB entries) |
Domain d1g5id2: 1g5i D:40-337 [60285] Other proteins in same PDB: d1g5ia1, d1g5ia3, d1g5ib1, d1g5ib3, d1g5ic1, d1g5ic3, d1g5id1, d1g5id3 complexed with gol, na |
PDB Entry: 1g5i (more details), 2.3 Å
SCOPe Domain Sequences for d1g5id2:
Sequence, based on SEQRES records: (download)
>d1g5id2 d.104.1.1 (D:40-337) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv favdslhqepgssqprdsafrlvspesireilqdrepskeqlvaflenllktsgklratl lhgalehyvncldlvnrklpfglaqigvcfhpvsnsnqtpssvtrvgekteaslvwftpt rtssqwldfwlrhrllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwn lgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlaensfar
>d1g5id2 d.104.1.1 (D:40-337) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} realvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqv favdslhqepgrdsafrlvspesireilqdrepskeqlvaflenllktsgklratllhga lehyvncldlvnrklpfglaqigvcfhpvsrvgekteaslvwftptrtssqwldfwlrhr llwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgnv stiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfqlaensfar
Timeline for d1g5id2: