Lineage for d1g5ic1 (1g5i C:343-459)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489768Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2489838Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)
  7. 2489846Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries)
  8. 2489849Domain d1g5ic1: 1g5i C:343-459 [60282]
    Other proteins in same PDB: d1g5ia2, d1g5ia3, d1g5ib2, d1g5ib3, d1g5ic2, d1g5ic3, d1g5id2, d1g5id3
    complexed with gol, na

Details for d1g5ic1

PDB Entry: 1g5i (more details), 2.3 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma
PDB Compounds: (C:) mitochondrial DNA polymerase accessory subunit

SCOPe Domain Sequences for d1g5ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ic1 c.51.1.1 (C:343-459) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql
hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnv

SCOPe Domain Coordinates for d1g5ic1:

Click to download the PDB-style file with coordinates for d1g5ic1.
(The format of our PDB-style files is described here.)

Timeline for d1g5ic1: