Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries) |
Domain d1g5ic1: 1g5i C:343-459 [60282] Other proteins in same PDB: d1g5ia2, d1g5ia3, d1g5ib2, d1g5ib3, d1g5ic2, d1g5ic3, d1g5id2, d1g5id3 complexed with gol, na |
PDB Entry: 1g5i (more details), 2.3 Å
SCOPe Domain Sequences for d1g5ic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ic1 c.51.1.1 (C:343-459) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnv
Timeline for d1g5ic1: