| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
| Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries) |
| Domain d1g5ib1: 1g5i B:343-460 [60280] Other proteins in same PDB: d1g5ia2, d1g5ib2, d1g5ic2, d1g5id2 |
PDB Entry: 1g5i (more details), 2.3 Å
SCOP Domain Sequences for d1g5ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ib1 c.51.1.1 (B:343-460) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus)}
rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql
hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnva
Timeline for d1g5ib1: