SCOP 1.73: Domain d1g5ia1: 1g5i A:343-469

Lineage for d1g5ia1 (1g5i A:343-469)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)
Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries)
Domain d1g5ia1: 1g5i A:343-469 [60278]
Other proteins in same PDB: d1g5ia2, d1g5ib2, d1g5ic2, d1g5id2

Details for d1g5ia1

PDB Entry: 1g5i (more details), 2.3 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma

PDB Compounds: (A:) mitochondrial DNA polymerase accessory subunit

SCOP Domain Sequences for d1g5ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ia1 c.51.1.1 (A:343-469) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql
hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnvaaa
ldhhhhh

SCOP Domain Coordinates for d1g5ia1:

Click to download the PDB-style file with coordinates for d1g5ia1.
(The format of our PDB-style files is described here.)

Timeline for d1g5ia1: