SCOP 1.57: Domain d1g5hd1: 1g5h D:338-468

Lineage for d1g5hd1 (1g5h D:338-468)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries)

8. Domain d1g5hd1: 1g5h D:338-468 [60276]
   Other proteins in same PDB: d1g5ha2, d1g5hb2, d1g5hc2, d1g5hd2

Details for d1g5hd1

PDB Entry: 1g5h, 1.95 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma

SCOP Domain Sequences for d1g5hd1:

Sequence; same for both SEQRES and ATOM records:

>d1g5hd1 c.51.1.1 (D:338-468) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus)}
kkslqrkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhs
sleqlhskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasas
nvaaaldhhhh

Timeline for d1g5hd1:

• d1g5hd1 is new in SCOP 1.57
  
• d1g5hd1 appears in SCOP 1.59
  
• d1g5hd1 appears in the current release, SCOPe 2.08