SCOPe 2.02: Domain d1g5hc2: 1g5h C:41-330

Lineage for d1g5hc2 (1g5h C:41-330)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64350] (2 PDB entries)

8. Domain d1g5hc2: 1g5h C:41-330 [60275]
   Other proteins in same PDB: d1g5ha1, d1g5hb1, d1g5hc1, d1g5hd1
   complexed with gol, na

Details for d1g5hc2

PDB Entry: 1g5h, 1.95 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma

PDB Compounds: (C:) mitochondrial DNA polymerase accessory subunit

SCOPe Domain Sequences for d1g5hc2:

Sequence, based on SEQRES records:

>d1g5hc2 d.104.1.1 (C:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf
avdslhqepgssqprdsafrlvspesireilqdrepskeqlvaflenllktsgklratll
hgalehyvncldlvnrklpfglaqigvcfhpvsnsnqtpssvtrvgekteaslvwftptr
tssqwldfwlrhrllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnl
gdqellhtypgnvstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfql

Sequence, based on observed residues (ATOM records):

>d1g5hc2 d.104.1.1 (C:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ealvdlcrrrhflsgtpqqlstaallsgcharfgplgvelrknlasqwwssmvvfreqvf
avdslhqepgssqprdsafrlvspesireilqdskeqlvaflenllktsgklratllhga
lehyvncldlvnrklpfglaqigvcfhpvstrvgekteaslvwftptrtssqwldfwlrh
rllwwrkfamspsnfssadcqdelgrkgsklyysfpwgkepietlwnlgdqellhtypgn
vstiqgrdgrknvvpcvlsvsgdvdlgtlaylydsfql

Timeline for d1g5hc2:

• d1g5hc2 first appeared in SCOP 1.57
  
• d1g5hc2 appears in SCOPe 2.01
  
• d1g5hc2 appears in SCOPe 2.03
  
• d1g5hc2 appears in the current release, SCOPe 2.08