Lineage for d1g5ha1 (1g5h A:343-469)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487574Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 487575Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 487576Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 487639Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (1 species)
  7. 487640Species Mouse (Mus musculus) [TaxId:10090] [64074] (2 PDB entries)
  8. 487641Domain d1g5ha1: 1g5h A:343-469 [60270]
    Other proteins in same PDB: d1g5ha2, d1g5hb2, d1g5hc2, d1g5hd2

Details for d1g5ha1

PDB Entry: 1g5h (more details), 1.95 Å

PDB Description: crystal structure of the accessory subunit of murine mitochondrial polymerase gamma

SCOP Domain Sequences for d1g5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ha1 c.51.1.1 (A:343-469) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus)}
rkvlklhpclapikvaldvgkgptvelrqvcqgllnellengisvwpgysetvhssleql
hskydemsvlfsvlvtettlengliqlrsrdttmkemmhisklrdflvkylasasnvaaa
ldhhhhh

SCOP Domain Coordinates for d1g5ha1:

Click to download the PDB-style file with coordinates for d1g5ha1.
(The format of our PDB-style files is described here.)

Timeline for d1g5ha1: