Lineage for d1g5cc_ (1g5c C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124189Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 124226Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family) (S)
  5. 124227Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein)
  6. 124228Protein beta-carbonic anhydrase [53058] (4 species)
  7. 124229Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [64084] (1 PDB entry)
  8. 124232Domain d1g5cc_: 1g5c C: [60266]

Details for d1g5cc_

PDB Entry: 1g5c (more details), 2.1 Å

PDB Description: crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1g5cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5cc_ c.53.2.1 (C:) beta-carbonic anhydrase {Archaeon Methanobacterium thermoautotrophicum}
iikdilrenqdfrfrdlsdlkhspklciitcmdsrlidlleralgigrgdakviknagni
vddgvirsaavaiyalgdneiiivghtdcgmarldedlivsrmrelgveeevienfsidv
lnpvgdeeenviegvkrlkssplipesigvhgliidintgrlkplylde

SCOP Domain Coordinates for d1g5cc_:

Click to download the PDB-style file with coordinates for d1g5cc_.
(The format of our PDB-style files is described here.)

Timeline for d1g5cc_: