SCOP 1.57: Domain d1g5cc_: 1g5c C:

Lineage for d1g5cc_ (1g5c C:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family)

5. Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein)

6. Protein beta-carbonic anhydrase [53058] (4 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [64084] (1 PDB entry)

8. Domain d1g5cc_: 1g5c C: [60266]

Details for d1g5cc_

PDB Entry: 1g5c, 2.1 Å

PDB Description: crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1g5cc_:

Sequence; same for both SEQRES and ATOM records:

>d1g5cc_ c.53.2.1 (C:) beta-carbonic anhydrase {Archaeon Methanobacterium thermoautotrophicum}
iikdilrenqdfrfrdlsdlkhspklciitcmdsrlidlleralgigrgdakviknagni
vddgvirsaavaiyalgdneiiivghtdcgmarldedlivsrmrelgveeevienfsidv
lnpvgdeeenviegvkrlkssplipesigvhgliidintgrlkplylde

Timeline for d1g5cc_:

• d1g5cc_ is new in SCOP 1.57
  
• d1g5cc_ appears in SCOP 1.59
  
• d1g5cc_ appears in the current release, SCOPe 2.08