SCOPe 2.06: Domain d1g5cb_: 1g5c B:

Lineage for d1g5cb_ (1g5c B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)

6. Protein beta-carbonic anhydrase [53058] (4 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [64084] (1 PDB entry)

8. Domain d1g5cb_: 1g5c B: [60265]
   complexed with ca, epe, zn

Details for d1g5cb_

PDB Entry: 1g5c, 2.1 Å

PDB Description: crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum

PDB Compounds: (B:) beta-carbonic anhydrase

SCOPe Domain Sequences for d1g5cb_:

Sequence, based on SEQRES records:

>d1g5cb_ c.53.2.1 (B:) beta-carbonic anhydrase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikdilrenqdfrfrdlsdlkhspklciitcmdsrlidlleralgigrgdakviknagni
vddgvirsaavaiyalgdneiiivghtdcgmarldedlivsrmrelgveeevienfsidv
lnpvgdeeenviegvkrlkssplipesigvhgliidintgrlkplylde

Sequence, based on observed residues (ATOM records):

>d1g5cb_ c.53.2.1 (B:) beta-carbonic anhydrase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikdilrenqdspklciitcmdsrlidlleralgigrgdakviknagnivddgvirsaav
aiyalgdneiiivghtdcgmarldedlivsrmrelgveeevienfsidvlnpvgdeeenv
iegvkrlkssplipesigvhgliidintgrlkplylde

Timeline for d1g5cb_:

• d1g5cb_ first appeared in SCOP 1.57
  
• d1g5cb_ appears in SCOPe 2.05
  
• d1g5cb_ appears in SCOPe 2.07
  
• d1g5cb_ appears in the current release, SCOPe 2.08