Lineage for d1g5bc_ (1g5b C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513496Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins)
  6. 513497Protein lambda ser/thr protein phosphatase [64431] (1 species)
  7. 513498Species Bacteriophage lambda [TaxId:10710] [64432] (1 PDB entry)
  8. 513501Domain d1g5bc_: 1g5b C: [60263]

Details for d1g5bc_

PDB Entry: 1g5b (more details), 2.15 Å

PDB Description: bacteriophage lambda ser/thr protein phosphatase

SCOP Domain Sequences for d1g5bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5bc_ d.159.1.3 (C:) lambda ser/thr protein phosphatase {Bacteriophage lambda}
mryyekidgskyrniwvvgdlhgcytnlmnkldtigfdnkkdllisvgdlvdrgaenvec
lelitfpwfravrgnheqmmidglsergnvnhwllngggwffnldydkeilakalahkad
elpliielvskdkkyvichadypfdeyefgkpvdhqqviwnrerisnsqngivkeikgad
tfifghtpavkplkfanqmyidtgavfcgnltliqvqgaga

SCOP Domain Coordinates for d1g5bc_:

Click to download the PDB-style file with coordinates for d1g5bc_.
(The format of our PDB-style files is described here.)

Timeline for d1g5bc_: